The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205-237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certain autoimmune disorders, including Sjögren's syndrome (SS). Autoantibodies against M3R(228-237) have been shown to interfere with the function of M3R. However, few studies have been performed on the...

Received: August 2016; Accepted: November 2016. Send correspondence to: Cristina Casajuana Kögel. c/Rosselló 149; 08036 Barcelona (Spain). E-mail: [email protected]. Telephone number : +(34) 93 227 54 00 (ext. 4210). Fax number: +(34) 93 227 54 00 (ext. 1750) Psychoactive constituents of cannabis and their clinical implications: a systematic review Constituyentes psicoactivos del cannabis ...

Alpha-emitting radionuclides are highly cytotoxic and are of considerable interest in the treatment of cancer. A particularly interesting approach is in radioimmunotherapy. However, alpha-emitting antibody conjugates have been difficult to exploit clinically due to the short half-life of the radionuclides, low production capability, or limited source materials. We have developed a novel technol...

We have carefully examined the frequency of guanidine-resistant revertants in six different clonal pools of guanidine-dependent mutants of type 1 poliovirus. The mutation frequency was (6.5 +/- 6.3) x 10(-4) (with all amino acid substitutions occurring at position 227). The minimal corrected base substitution frequency per single nucleotide site in the codon for amino acid 227 was (2.1 +/- 1.9)...

Number : 002-0039 Title of the paper : Modelling the human scheduler in a FMS: a knowledge-based system approach Name of Conference : 2 World Conference on POM, Cancun , Mexico Author Dr. James F. O'Kane Programme Director Research & Enterprise Newcastle Business School University of Northumbria Newcastle Upon Tyne NE1 8ST Tel 0191-227-3839 Fax 0191-227-4684 [email protected]

Idiomarina abyssalis KMM 227(T) is an aerobic flagellar gammaproteobacterium found at a depth of 4,000 to 5,000 m below sea level in the Pacific Ocean. This paper presents a draft genome sequence for I. abyssalis KMM 227(T), with a predicted composition of 2,684,812 bp (47.15% G+C content) and 2,611 genes, of which 2,508 were predicted coding sequences.

IJVM (2013), 7(3):227-231 227 First report on Anaplasma platys infection in a dog in the Philippines Adrian Patalinghug Ybañez Department of Veterinary Clinical Science, Obihiro University of Agriculture and Veterinary Medicine, Obihiro city Hokkaido, Japan United Graduate School of Veterinary Sciences, Gifu University, Gifu, Japan College of Veterinary Medicine and Department of Animal Science...

117, Text Words; 2163, Figures; 3, Table; 0 Running Title; Protection of RGC with free radical scavengers *Correspondence: Hiroyuki Nawa Division of Molecular Neurobiology Brain Research Institute, Niigata University 1-757 Asahimachi, Chuo-ku, Niigata 951-8585, Japan Tel. +81-25-227-0613 Fax. +81-25-227-0815 e-mail: [email protected]

PERSPECTIVE ................................................................ 222 A Fruitless Search and Its Consequences ................................................................ 222 Three Ideas That Shape Our Concept of Bacterial Evolution .......................................................224 Procaryote-eucaryote dichotomy ..............................................................