Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
نویسندگان
چکیده
Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.
منابع مشابه
Biochemical and in Silico Clotting Activity of Latex from Asclepias Curassavica.l
The crude latex extract of Asclepias curassavica contains many proteins and exhibits strong proteolytic activity. The study was done to identify the clotting factor present in the latex of Asclepias curassavica and to analyze the thrombin like activity of the clotting factor. In this study the plant latex from Asclepias curassavica was collected and extracted the proteins. Proteolytic assays an...
متن کاملاستخراج، شناسایی و بررسی فعالیت آنزیم پاپائین میوه Carica papaya از ایران
Background and purpose: Papain, a proteolytic enzyme, is found in the dried and purified latex from the fruits of Carica papaya L. (Caricaceae). Papain is used in medicine as a digestive and in the debridement of necrotic tissues. It is used in pharmaceutics as a spreading agent for drugs, supplied as an ointment (10%) with urea which denatures nonviable protein matter present in lesions. ...
متن کاملبررسی مکانیسم های مهاری پروتئین های Spike، Protease اصلی و Papain like protease در کرونا ویروس با استفاده از شبیه سازی و داکینگ
متن کامل
Physicochemical Properties of the Proteolytic Enzyme from the Latex of the Milkweed, Asclepias Speciosa Torr. Some Comparisons with Other Proteases
1. The rates of heat inactivation of papain, bromelin, and asclepain were determined at several different temperatures. Papain was by far the most resistant to heat. 2. The destruction of papain at 75-83 degrees and bromelin at 55-70 degrees followed the course of a first order reaction, except that for longer times of heating, bromelin (at 60-70 degrees ) was inactivated more rapidly than the ...
متن کاملPlant-derived differences in the composition of aphid honeydew and their effects on colonies of aphid-tending ants
In plant-ant-hemipteran interactions, ants visit plants to consume the honeydew produced by phloem-feeding hemipterans. If genetically based differences in plant phloem chemistry change the chemical composition of hemipteran honeydew, then the plant's genetic constitution could have indirect effects on ants via the hemipterans. If such effects change ant behavior, they could feed back to affect...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید
ثبت ناماگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید
ورودعنوان ژورنال:
- Acta biochimica et biophysica Sinica
دوره 41 2 شماره
صفحات -
تاریخ انتشار 2009