Bioactive properties and clinical safety of a novel milk protein peptide
نویسندگان
چکیده
منابع مشابه
Bioactive properties and clinical safety of a novel milk protein peptide
BACKGROUND Milk protein fractions and peptides have been shown to have bioactive properties. This preliminary study examined the potential mechanisms of action and clinical safety of novel milk protein peptide (MP). FINDINGS A novel MP mixture inhibits the tyrosine kinase activity of epidermal growth factor receptor (EGFR), vascular endothelial growth factor receptor 2 (VEGFR2), and insulin r...
متن کاملwuthering heights and the concept of marality/a sociological study of the novel
to discuss my point, i have collected quite a number of articles, anthologies, and books about "wuthering heights" applying various ideas and theories to this fantastic story. hence, i have come to believe that gadamer and jauss are rightful when they claim that "the individaul human mind is the center and origin of all meaning," 3 that reading literature is a reader-oriented activity, that it ...
15 صفحه اولPeptide and Protein Delivery at a Glance
Peptide and protein drugs have found an important position in therapeutics. Recent advances in pharmaceutical biotechnology have led to an increase in the number of protein products in the market. As these therapeutic proteins and peptides are made available, it will be essential to formulate these drugs into safe and effective delivery systems. The twenty different naturally occurring amin...
متن کاملA novel bioactive peptide from wasp venom
Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...
متن کاملPeptide and Protein Delivery at a Glance
Peptide and protein drugs have found an important position in therapeutics. Recent advances in pharmaceutical biotechnology have led to an increase in the number of protein products in the market. As these therapeutic proteins and peptides are made available, it will be essential to formulate these drugs into safe and effective delivery systems. The twenty different naturally occurring amin...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: Nutrition Journal
سال: 2011
ISSN: 1475-2891
DOI: 10.1186/1475-2891-10-99