El objetivo de este trabajo es identificar y caracterizar el escenario desigualdad en los hogares Sonora función sus niveles acceso a servicios energía capital económico, para analizar posibles impactos adversos que puede generar confinamiento por la pandemia del COVID-19. Se aplicó una metodología cuantitativa incluyó las técnicas análisis correspondencias múltiple clúster k-medias. Los result...

Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...

This study involved a campaign to isolate and study additional latrunculin analogues from two taxonomically unrelated sponges, Cacospongia mycofijiensis and Negombata magnifica. A total of 13 latrunculin analogues were obtained by four different ways, reisolation (1-4), our repository (5, 6), new derivatives (7-12), and a synthetic analogue (7a). The structures of the new metabolites were eluci...

Myiasis is a disease caused by fly larvae and aural myiasis is a rare clinic condition often occuring in children or mentally retarded people. We report the case of an unusual presentation of a bilateral aural myiasis in a mentally retarded patient with bilateral chronic otitis media caused by the third instar larvae of Wohlfahrtia magnifica. Two larvae were located on the other ear canal while...

Snow, N., J.W. Dawson†, J. Munzinger & M.W. Callmander (2022). Additional taxonomic and nomenclatural notes on New Caledonian Eugenia (Myrtaceae). Candollea 77: 71–79. In English, English French abstracts. Ongoing studies L. (Myrtaceae) in Caledonia revealed a number of issues need clarification. A new synonymy is proposed: Schizocalyx neocaledonica Brongn. Gris reduced to under ovigera Gris. n...

Tropical Vochysiaceae includes mainly trees, and also shrubs and subshrubs. Three genera and seven species are present in the Brazilian state of Santa Catarina. The pollen morphology of six species of trees, belonging to three genera of the Vochysiaceae A. St-Hil. family, was studied. Herbaria samples were obtained, processed and treated by standard methods. The pollen grain morphology of Calli...