The stability of N-centered radicals and radical cations of potential relevance in C–H amidation reactions has been quantified using highly accurate theoretical methods. Combination with available C–H bond energies for substrate fragments allows for the prediction of reaction enthalpies in 1,5-hydrogen atom transfer (HAT) steps frequently encountered in reactions such as the Hoffman–Lçffler–Fre...

For biosynthesis of bacillamide C by Bacillus atrophaeus C89 associated with South China sea sponge Dysidea avara, it is hypothesized that decarboxylation from L-tryptophan to tryptamine could be performed before amidation by the downstream aromatic L-amino acid decarboxylase (AADC) to the non-ribosomal peptide synthetases (NRPS) gene cluster for biosynthesizing bacillamide C. The structural an...

A visible-light-promoted radical amidation/cyclization of arylacrylamides was realized by using N -aminopyridinium salts as the source amidyl radicals. variety amide-tethered-oxindoles were prepared in this way moderate to good yields.

The stereochemical course of the amidopalladation of alkenes has important implications for the development of enantioselective Pd-catalyzed "Wacker-type" oxidative amidation of alkenes. We have recently shown that the addition of base (Na2CO3) can alter the stereochemical course of amidopalladation in the (IMes)Pd(TFA)2(H2O)-catalyzed aerobic oxidative amidation of alkene. In this study, the m...

In vertebrates, the two-step peptide alpha-amidation reaction is catalyzed sequentially by two enzymatic activities contained within one bifunctional enzyme called PAM (peptidylglycine alpha-amidating mono-oxygenase). Drosophila head extracts contained both of these PAM-related enzyme activities: a mono-oxygenase (PHM) and a lyase (PAL). However, no bifunctional PAM protein was detected. We ide...

In this work, a modified version of the 44 amino acid human growth hormone-releasing hormone (hGHRH(1-44)) containing an N-terminal proline extension, a valine residue in position 14, and a C-terminus amidation (sequence: PYADAIFTNSYRKVVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 ) has been identified in a confiscated product by liquid chromatography-high resolution mass spectrometry (LC-HRMS). Investi...

The functionalization of C?H bonds in light alkanes, particularly to form C?N bonds, remains a challenge. We report the dehydrogenative coupling amides with C1–C4 hydrocarbons N-alkyl amide products tBuOOtBu as oxidant, and copper complex phenanthroline-type ligand catalyst. reactions occurred good yields benzene or supercritical carbon dioxide solvents. This strategy allowed for determination ...