نتایج جستجو برای: آهن ll

تعداد نتایج: 21259  

Journal: :Boletín de la Sociedad Geológica Mexicana 1962

2014
Kai Liao Lilei Yu Kang Yang Gaowa Saren Songyun Wang Bing Huang Hong Jiang Leonardo Barbosa Moraes Resstel

BACKGROUND The autonomic imbalance during acute ischemia is involved in the occurrence of life-threatening arrhythmias. OBJECTIVE To investigate the effect of autonomic nervous system (ANS) modulation by low-level carotid baroreceptor stimulation (LL-CBS) on ventricular ischemia arrhythmias. METHODS Anesthetized dogs were received either sham treatment (SHAM group, n = 10) or LL-CBS treatme...

Journal: :Journal of immunology 2005
Sho Tokumaru Koji Sayama Yuji Shirakata Hitoshi Komatsuzawa Kazuhisa Ouhara Yasushi Hanakawa Yoko Yahata Xiuju Dai Mikiko Tohyama Hiroshi Nagai Lujun Yang Shigeki Higashiyama Akihiko Yoshimura Motoyuki Sugai Koji Hashimoto

The closure of skin wounds is essential for resistance against microbial pathogens, and keratinocyte migration is an important step in skin wound healing. Cathelicidin hCAP18/LL-37 is an innate antimicrobial peptide that is expressed in the skin and acts to eliminate microbial pathogens. Because hCAP18/LL-37 is up-regulated at skin wound sites, we hypothesized that LL-37 induces keratinocyte mi...

2006
Wim H. Hesselink Jan Eppo Jonker

The algorithm of Jayanti and Petrovic (ICDCS 2005) gives a wait-free implementation of load-linked/store-conditional (LL/SC) for multiword variables, given LL/SC actions on single words. The authors gave a behavioural proof of correctness. We present a refinement proof that has been verified with the proof assistant PVS. We give an improved algorithm which needs fewer single-word LL/SC register...

Journal: :Molecular cancer research : MCR 2009
Jamie S Mader Neeloffer Mookherjee Robert E W Hancock R Chris Bleackley

LL-37 is a human cationic host defense peptide (antimicrobial peptide) belonging to the cathelicidin family of peptides. In this study, LL-37 was shown to kill Jurkat T leukemia cells via apoptosis. A loss of mitochondrial membrane potential, DNA fragmentation, and phosphatidylserine externalization were detected following LL-37 exposure, whereas apoptosis was independent of caspase family memb...

2015
Jennifer R. Honda Tamara Hess Kenneth C. Malcolm Alida R. Ovrutsky Xiyuan Bai Vida R. Irani Karen M. Dobos Edward D. Chan Sonia C. Flores

Nontuberculous mycobacteria (NTM) are a large group of environmental organisms with worldwide distribution, but only a relatively few are known to be pathogenic. Chronic, debilitating lung disease is the most common manifestation of NTM infection, which is often refractory to treatment. The incidence and prevalence of NTM lung disease are increasing in the United States and in many parts of the...

Journal: :Journal of innate immunity 2012
Anastasia Nijnik Jelena Pistolic Niall C J Filewod Robert E W Hancock

Cathelicidin LL-37 is a multifunctional immunomodulatory and antimicrobial host defense peptide that has an important role in the immune defenses of the skin and other epithelial barriers. We have previously demonstrated that at physiological concentrations LL-37 synergistically augments the production of immune mediators in response to microbial compounds in human primary keratinocytes. Here w...

Journal: :Molecular pharmacology 2006
Stéphanie Pochet Séverine Tandel Stéphanie Querriére Marie Tre-Hardy Mikel Garcia-Marcos Manuela De Lorenzi Michel Vandenbranden Aida Marino Michel Devleeschouwer Jean-Paul Dehaye

The interaction of mice submandibular gland cells with LL-37 ([LL-37, 37 aa]), a cationic peptide with immunomodulatory properties, was investigated. LL-37 at a concentration that did not affect the integrity of the cells increased the uptake of calcium and activated a calcium-insensitive phospholipase A(2) (PLA(2)). The small release of ATP induced by LL-37 could not acc...

2017
Yang Du Jia-Qi Liu Jie Tang Jun Ge Ye Chen Ke Cheng Jing Ding Zhi-Ke Li Ji-Yan Liu

OBJECTIVE This study aims to investigate biological behavior changes in a murine lung cancer cell characterized by acquired resistance to sunitinib, a potent inhibitor of multiple-targeted receptor tyrosine kinase. METHODS A lung cancer cell line resistant to sunitinib (LL/2-R) was developed from its parental cell line (LL/2-P). Differences in biological characteristics and associated molecul...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید