نتایج جستجو برای: deamidation

تعداد نتایج: 580  

Journal: :The Journal of pharmacology and experimental therapeutics 2007
Clark Q Pan Fugang Li Irene Tom Wei Wang Michael Dumas Wayne Froland Stephanie L Yung Yaxin Li Steve Roczniak Thomas H Claus Y John Wang James P Whelan

A previously described VPAC2-selective agonist, BAY 55-9837 (peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its potential as an insulin secretagogue for the treatment of type 2 diabetes. These limitations were primarily poor stability in aqueous buffer and short duration of action in vivo. In this report, we describe a series of novel analogs of BAY 55-9837 th...

Journal: :Digestive and liver disease : official journal of the Italian Society of Gastroenterology and the Italian Association for the Study of the Liver 2009
L Elli C M Bergamini M T Bardella D Schuppan

Transglutaminases are a family of eight currently known calcium-dependent enzymes that catalyze the cross-linking or deamidation of proteins. They are involved in important biological processes such as wound healing, tissue repair, fibrogenesis, apoptosis, inflammation and cell-cycle control. Therefore, they play important roles in the pathomechanisms of autoimmune, inflammatory and degenerativ...

Journal: :The Journal of biological chemistry 1965
B PETRACK P GREENGARD A CRASTON F SHEPPY

Previous studies from our laboratory indicated that the initial step in the biosynthesis of nicotinamide adenine dinucleotide from nicotinamide in mammalian liver involves the enzymatic deamidation of nicotinamide to nicotinic acid (1, 2). The nicotinic acid is then converted to NAD via the pathway described by Preiss and Handler, involving the intermediate formation of nicotinic acid mononucle...

Journal: :Frontiers in Immunology 2023

During gene therapy trials, immune responses against adeno-associated virus (AAV) vectors are monitored by antibody assays that detect the humoral and T-cell mediated cellular to AAV vectors. T cell commonly utilize collection of patients’ peripheral blood mononuclear cells (PBMCs) stimulation with AAV-derived overlapping peptides. We recently described spontaneous deamidation coincides epitope...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید