نتایج جستجو برای: deamidation
تعداد نتایج: 580 فیلتر نتایج به سال:
A previously described VPAC2-selective agonist, BAY 55-9837 (peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its potential as an insulin secretagogue for the treatment of type 2 diabetes. These limitations were primarily poor stability in aqueous buffer and short duration of action in vivo. In this report, we describe a series of novel analogs of BAY 55-9837 th...
Transglutaminases are a family of eight currently known calcium-dependent enzymes that catalyze the cross-linking or deamidation of proteins. They are involved in important biological processes such as wound healing, tissue repair, fibrogenesis, apoptosis, inflammation and cell-cycle control. Therefore, they play important roles in the pathomechanisms of autoimmune, inflammatory and degenerativ...
Previous studies from our laboratory indicated that the initial step in the biosynthesis of nicotinamide adenine dinucleotide from nicotinamide in mammalian liver involves the enzymatic deamidation of nicotinamide to nicotinic acid (1, 2). The nicotinic acid is then converted to NAD via the pathway described by Preiss and Handler, involving the intermediate formation of nicotinic acid mononucle...
During gene therapy trials, immune responses against adeno-associated virus (AAV) vectors are monitored by antibody assays that detect the humoral and T-cell mediated cellular to AAV vectors. T cell commonly utilize collection of patients’ peripheral blood mononuclear cells (PBMCs) stimulation with AAV-derived overlapping peptides. We recently described spontaneous deamidation coincides epitope...
نمودار تعداد نتایج جستجو در هر سال
با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید