نتایج جستجو برای: n 37
تعداد نتایج: 1075496 فیلتر نتایج به سال:
The interaction of mice submandibular gland cells with LL-37 ([LL-37, 37 aa]), a cationic peptide with immunomodulatory properties, was investigated. LL-37 at a concentration that did not affect the integrity of the cells increased the uptake of calcium and activated a calcium-insensitive phospholipase A(2) (PLA(2)). The small release of ATP induced by LL-37 could not acc...
BackgroundThe dietary intake of tennis athletes training at the University Limpopo (UL) were reported to be suboptimal. However, nutrition information sources guiding these remain unknown.MethodsA descriptive cross-sectional study was carried out purposively obtain 30 registered UL-affiliated team athletes. Data collected UL courts. Demographic data and used for sport using self-designed questi...
Neste artigo, considerando a redefinição do papel Estado e o redimensionamento das relações entre público privado partir dos anos de 1990, que tem por fundamento deslocamento grande parte da execução políticas sociais para grupos terceiro setor, empresas fundações institutos empresariais tenham interesse em prestar serviços colaboração com aparelhagem estatal, exploraremos alinhamento investime...
نمودار تعداد نتایج جستجو در هر سال
با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید