STUDY DESIGN A study of lumbar ligamentum flavum (LF). OBJECTIVE The aim of this study was to identify LF hypertrophy related microRNAs (miRNAs) expression profile and to investigate the role of miRNAs in the development of LF hypertrophy in lumbar spinal stenosis (LSS). SUMMARY OF BACKGROUND DATA Although histologic and biologic literature on LF hypertrophy is available, the pathomechanism...

Abstract We revisit low frequency coherent Raman spectroscopy (LF-CRS) and present a unified theoretical background that provides consistent physical pictures of LF-CRS signal generation. Our general framework allows to compute the noise ratio in multitude possible LF-CRS, more generally CRS, experimental implementations both spectral time domain.

The aims of the present study were to review the experience of different surgical reconstruction methods for hypopharyngeal squamous cell carcinoma (HSCC) and compared the survival of patients with and without laryngeal function (LF) preservation. The clinical characteristics of 580 patients were retrospectively obtained and analyzed. Survival curves were analyzed using the Kaplan‑Meier method ...

AIM To determine the efficacy, safety, and clinical value of a novel surgical procedure involving the blunt perforation of the ligamentum flavum (LF) during endoscopic interlaminar lumbar discectomy. MATERIAL AND METHODS This was a prospective study of 50 patients (27 males, 17-51 years of age) undergoing lumbar discectomy for single segment L4/L5 or L5/S1 disk herniation were grouped into th...

Lactoferrin (LF), a multifunctional molecule present in human secretions, has potent inhibitory activities against human immunodeficiency virus (HIV). The aim of the study was to evaluate whether human LF (hLF) and its exposed domain LF-33 represented by the peptide (LF-33-GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGP) involved in LF-HIV gag binding and endotoxines neutralization, may inhibit early steps o...

The effects of bovine lactoferrin (LF) or the LF-derived antimicrobial peptide lactoferricin B (LFcin B) on the growth of Candida albicans hyphae, including those of three azole-resistant strains, were investigated by a crystal violet staining method. The hyphae of two highly azole-resistant strains were more susceptible to inhibition by LF or LFcin B than the azole-susceptible strains tested. ...

The aim of the present study was to assess if some flavonic compounds (quercetin, piceatannol and apigenin) and ascorbic acid could interfere with the Lf stimulatory effect on the erythrocyte function. Quercetin (1.5 microM) and piceatannol (30 microM) showed an additive effect on Lf stimulation of Na+/ K+-ATPase when used together with Lf. The enhancement of Lf stimulation on Na+/ K+-ATPase in...

Bovine lactoferrin (LF) is mainly present in milk and shows important physiological and biological functions. The aim of this study was to estimate the heritability and correlation values of LF content in bovine milk with different economic traits as milk yield (MY), fat and protein percentages, and somatic cell score (SCS). Variance components of the studied traits were estimated by REML using...

AIM To evaluate the long-term perimetric fluctuation (LF) in patients with different stages of glaucoma according to the Glaucoma Staging System 2 (GSS2). METHODS This multicentre retrospective study included 161 eyes of 161 stable glaucoma patients undergoing four visual-field tests (Humphrey SITA-Standard program over the central 24° or 30°) over a 2-year period. For each patient, the stage...

Experiments were conducted to quantify downstream heating from inclined fires generated by a 25 cm wide, 5 deep gaseous line burner. A variety of orientation angles (?) and fire heat-release rates (HRR) employed simulating, at reduced scale, the dynamics two-dimensional (2-D) flame spread as found in wildland or building fires. The total heat flux q?f?(x) nearly-adiabatic surface ahead burner w...