tio2/zro2 nanocomposite was obtained by the sonochemical technique. in this method, two separate gels containing zirconium and titanium were prepared and mixed together. the precursor sol of zirconium was prepared from an aqueous solution of zrcl4. the precursor titanium tetra isopropoxide (ttip) dissolved in isopropanol. mixing of titanium and zirconium gels was resulted in a yellow tio2/zro2 ...

in the past decades, many methods have been developed to synthesize zero- dimensional  nanoparticles, quasi–one–dimensional (1d) cuo nanostructures, such as metal organic deposition technique,  microwave irradiation, sol-gel-like dip  technique, reverse micelle-assisted route, chemical method, and simple template free solution route. among those synthesis methods, hydrothermal and chemical reac...

Sialylation is essential for development and regeneration in mammals. Using N-propanoylmannosamine, a novel precursor of sialic acid, we were able to incorporate unnatural sialic acids with a prolonged N-acyl side chain (e.g., N-propanoylneuraminic acid) into cell surface glycoconjugates. Here we report that this biochemical engineering of sialic acid leads to a stimulation of neuronal cells. B...

Each ommatidium of the Drosophila eye is constructed by precisely 19 specified precursor cells, generated in part during a second mitotic wave of cell divisions that overlaps early stages of ommatidial cell specification. Homozygotes for the pineapple eye mutation lack sufficient precursor cells due to apoptosis during the period of fate specification. In addition development is delayed by apop...

MicroRNAs (miRNAs) are a set of short (21-24 nt) noncoding RNAs that play significant regulatory roles in cells. In the past few years, research on miRNA-related problems has become a hot field of bioinformatics because of miRNAs' essential biological function. miRNA-related bioinformatics analysis is beneficial in several aspects, including the functions of miRNAs and other genes, the regulato...

BACKGROUND Mutations of the amyloid precursor protein gene (APP) are found in familial forms of Alzheimer's disease (AD) and some lead to the elevated production of amyloid-beta-protein (Abeta). While Abeta has been implicated in the causation of AD, the exact role played by Abeta and its APP precursor are still unclear. PRINCIPAL FINDINGS In our study, Drosophila melanogaster transgenics wer...

In our searching program for novel sorbicillin related compounds, three novel compounds, spirosorbicillinols A (1), B (2), and C (3), were isolated from the fermentation broth of the USF-4860 strain isolated from a soil sample. The planar structures of compounds 1-3 were determined from spectroscopic evidence and degradation reaction, and that of 1 was the same as that of 2. The relative stereo...

MicroRNAs are an important subclass of non-coding RNAs (ncRNA), and serve as main players into RNA interference (RNAi). Mature microRNA derived from stem-loop structure called precursor. Identification of precursor microRNA (pre-miRNA) is essential step to target microRNA in whole genome. The present work proposed 25 novel local features for identifying stemloop structure of pre-miRNAs, which c...

Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...

Abstract Nitrogen doping of carbon nanomaterials has emerged as a method to develop novel material properties, though limitations in the form extended treatment times, harsh chemical usage and limited total nitrogen content exist. Here, macroscopic ribbon-like assemblies nanotubes are functionalized with using simple direct current-based plasma–liquid system. This system utilizes plasma-generat...