The asymmetric transfer hydrogenation (ATH) of imines catalyzed by the Noyori-Ikariya [RuCl(η6-arene)(N-arylsulfonyl-DPEN)] (DPEN=1,2-diphenylethylene-1,2-diamine) half-sandwich complexes is a research topic that is still being intensively developed. This article focuses on selected aspects of this catalytic system. First, a great deal of attention is devoted to the N-arylsulfonyl moiety of the...

Hainantoxin-IV (HNTX-IV) can specifically inhibit the neuronal tetrodotoxin-sensitive sodium channels and defines a new class of depressant spider toxin. The sequence of native HNTX-IV is ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH(2). In the present study, to obtain further insight into the primary and tertiary structural requirements of neuronal sodium channel blockers, we determined the solution ...

The cyclotides are a large family of circular mini-proteins containing a cystine knot motif. They are expressed in plants as defense-related proteins, with insecticidal activity. Here we investigate their role in membrane interaction and disruption. Kalata B1, a prototypic cyclotide, was found to induce leakage of the self-quenching fluorophore, carboxyfluorescein, from phospholipid vesicles. A...

Music is composed of a set regular sound waves, which are usually ordered and have large number repetitive structures. Important notes, chords, music fragments often appear repeatedly. Such repeated (referred to as motifs) the soul song. However, most generated by existing generation methods can not distinct motifs like real music. This study proposes novel multi- encoders model called Motif Tr...

the remaining artworks from different periods and places in iran show the beliefs, customs, traditions and life in that times and places. using men’s motifs has been prevalent in the remained works of different civilizations and historical periods since the most ancient times. one of the most important and oldest civilizations of the iran plateau is elam. elam was an ancient civilization center...

RNAs are modular biomolecules, composed largely of conserved structural subunits, or motifs. These structural motifs comprise the secondary structure of RNA and are knit together via tertiary interactions into a compact, functional, three-dimensional structure and are to be distinguished from motifs defined by sequence or function. A relatively small number of structural motifs are found repeat...

In this world, the shapes of objects, including Batik motifs in Indonesia, are regular and irregular. One is Surya Kawung from Mojokerto. The purpose research to observe ability Electrical Engineering Department students Maranatha Christian University study reconstruct geometric Batik. making motifs, methods employed survey, observation, exploration, testing, improvement, while learning process...

Super-Secondary structure elements (super-SSEs) are the structurally conserved ensembles of secondary structure elements (SSEs) within a protein. They are of great biological interest. In this work, we present a method to formally represent and mine the sequence order independent super-SSE motifs that occur repeatedly in large data sets of protein structures. We represent a protein structure as...

Short, linear motifs (SLiMs) play a critical role in many biological processes, particularly in protein-protein interactions. Overrepresentation of convergent occurrences of motifs in proteins with a common attribute (such as similar subcellular location or a shared interaction partner) provides a feasible means to discover novel occurrences computationally. The SLiMDisc (Short, Linear Motif Di...