نتایج جستجو برای: leibnitz

تعداد نتایج: 164  

1998
Franz Huber Sascha Molterer Bernhard Sch Oscar Slotosch Alexander Vilbig

In this paper we present a case study on Auto Focus a tool prototype for the development of dis tributed and concurrent systems based on the con cepts of the formal method Focus We develop spec ify consistency check and simulate the controller of a pedestrian tra c light using di erent graphical de scription techniques to illustrate an engineering pro cess for concurrent systems Introduction Th...

1998
S. Partula A. de Guerra J. S. Fellah J. Charlemagne D. L. DiGiusto P. Borgulya H. Kishi Y. Uematsu H. von Boehmer H. Suzuki J. A. Punt L. G. Granger W. Swat L. Ignatowicz P. Kisielow B. A. Osborne Y. Takahama S. O. Sharrow A. Singer D. M. Page L. P. Kane J. P. Allison S. M. Hedrick J. Alberola-Ila K. A. Hogquist K. A. Swan M. J. Bevan R. M. Perlmutter C. C. O’Shea T. Crompton I. R. Rosewell A. C. Hayday M. J. Owen

Immunol. 157, 207 (1996). 10. D. L. DiGiusto and E. Palmer, Mol. Immunol. 31, 693 (1994). 11. The a wild-type, b wild-type, aIII, and bIII constructs have been previously described (8). The a wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS (30), with the a-CPM indicated in bold. The b wild-type amino acid sequence fro...

Journal: :Clinical chemistry 2014
Marek H Dominiczak

The gothic cathedral is a spectacular achievement of the European Middle Ages. Architecturally, these buildings incorporated revolutionary innovations both in the aesthetics of their design and in their construction. Comparing them to the earlier Romanesque cathedrals, one can observe that the semicircular window arches were substituted with pointed ones. Underneath, the entire weight distribut...

2015
Daniel Leivant Piergiorgio Odifreddi

This work describes a family of homomorphisms that contract natural deductions into typed ^-expressions, with the property that a convergence proof for an untyped program for function / is contracted to a typed program for /. The main novelties, compared to previous works on extracting algorithms from proofs, are the reading of deductions themselves as programs, and that instead of a constructi...

1999
Christopher M Gold Geoffrey Edwards

Traditional raster-based map or image manipulation techniques are known frequently to produce different results from vector implementations of the same operation. In addition, rasters require resampling and information loss for most resizing and rotation transformations, while vector maps in a GIS require complex and error-prone procedures to define neighbours, adjacency, connectedness, etc. Th...

2008
S Roth W Westphal

The CRESST (Cryogenic Rare Event Search with Superconducting Thermometers) and the EURECA (European Underground Rare Event Calorimeter Array) experiments are direct dark matter search experiments where cryogenic detectors are used to detect spin-independent, coherent WIMP (Weakly Interacting Massive Particle)-nucleon scattering events by means of the recoil energy. The cryogenic detectors use a...

Journal: :EURASIP J. Wireless Comm. and Networking 2012
Gen Motoyoshi Kenji Leibnitz Masayuki Murata

Several task forces are currently working on how to design the future Internet and it is high time for research work to also move a step forward to future mobile networks on a large scale. In this article, we propose a future mobile network management method based on a combination of OpenFlow and the biologically inspired attractor selection method to achieve scalability and energy efficiency. ...

1996
Gaetano Fiore

We present the Euclidean Hopf algebra Uq(e N ) dual of Fun(Rq >⊳SOq−1(N)) and describe its fundamental Hilbert space representations [6], which turn out to be rather simple “ lattice-regularized ” versions of the classical ones, in the sense that the spectra of squared momentum components are discrete and the corresponding eigenfunctions normalizable. A suitable notion of classical limit is int...

Journal: :Daedalus 2022

This dialogue is from an early scene in the 2014 film Ex Machina, which Nathan has invited Caleb to determine whether succeeded creating artificial intelligence.1 The achievement of powerful general intelligence long held a grip on our imagination not only for its exciting as well worrisome possibilities, but also suggestion new, uncharted era humanity. In opening his 2021 BBC Reith Lectures, t...

Journal: :Automatica 2003
Paulo Tabuada George J. Pappas

IONS OF HAMILTONIAN CONTROL SYSTEMS PAULO TABUADA AND GEORGE J. PAPPAS Abstra t. Given a ontrol system and a desired property, an abstra ted system is a redu ed system that preserves the property of interest while ignoring modeling detail. In previous work, we onsidered abstra tions of linear and analyti ontrol systems while preserving rea hability properties. In this paper we onsider the abstr...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید