BACKGROUND BAY 86-6150 is a new human recombinant factor VIIa variant developed for high procoagulant activity and longer action in people with hemophilia with inhibitors. OBJECTIVES To investigate the safety, tolerability, pharmacodynamics, pharmacokinetics and immunogenicity of BAY 86-6150 in non-bleeding hemophilia subjects. METHODS The study included non-bleeding men (18-65 years of age...

BACKGROUND By the formation of cGMP, nitric oxide (NO)-sensitive guanylyl cyclase (GC) acts as the effector for the signaling molecule NO and mediates the relaxation of vascular smooth muscle and the inhibition of platelet aggregation. The compounds YC-1 and BAY 41-2272 are regarded as NO-independent activators and sensitizers of NO-sensitive GC. In vivo effects, for example, lowering blood pre...

Selective inhibition of exclusively transcription-regulating PTEFb/CDK9 is a promising new approach in cancer therapy. Starting from lead compound BAY-958, lead optimization efforts strictly focusing on kinase selectivity, physicochemical and DMPK properties finally led to the identification of the orally available clinical candidate atuveciclib (BAY 1143572). Structurally characterized by an u...

Surface ozone (O3) was analyzed to investigate the role of the bay breeze on air quality at two locations in Edgewood, Maryland (lat: 39.4°, lon: −76.3°) for the month of July 2011. Measurements were taken as part of the first year of NASA’s “Deriving Information on Surface Conditions from Column and Vertically Resolved Observations Relevant to Air Quality” (DISCOVER-AQ) Earth Venture campaign ...

We tested the importance of in situ microphytobenthos (MPB) and transported material (seagrass, seagrass epiphytic algae,mangroves, saltmarsh succulents and saltmarsh grass in adjacent habitats) as ultimate sources of carbon to fish caught over mudflats. We measured dC values of these 6 autotrophs and 22 fish species in the subtropical waters of Moreton Bay, Queensland, Australia. All fish dC v...

Since arriving at the University of Wisconsin—Green Bay as Chancellor late last summer I have said the University’s commitment to the ideals of interdisciplinarity, a founding principle, is both one of our the most important assets and potentially one of the strongest inertial forces to our progress. Our claim of a unique approach to interdisciplinarity is part of our identity. It is part of ou...

leading to "less desirable" conditions in the estuary. Studies of the effects of thermal discharges have failed to document any substantial damage from present inputs. Perhaps the most disturbing aspects of Holden's articles are contained not in her "floating statistics," but in the following three sentences: "Although the bay has long been a laboratory for marine scientists, no comprehensive p...

A system of barrier islands and back-barrier bays occurs along southern Long Island, New York, and in many coastal areas worldwide. Characterizing the bay physical response to water level fluctuations is needed to understand flooding during extreme events and evaluate their relation to geomorphological changes. Offshore sea level is one of the main drivers of water level fluctuations in semienc...

A previously described VPAC2-selective agonist, BAY 55-9837 (peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its potential as an insulin secretagogue for the treatment of type 2 diabetes. These limitations were primarily poor stability in aqueous buffer and short duration of action in vivo. In this report, we describe a series of novel analogs of BAY 55-9837 th...