The antioxidant effect of porcine pancreatic phospholipase A2 (PLA2) was previously demonstrated. Understanding how PLA2 inhibits lipid oxidation promoted by hemoglobin (Hb) is important for its applications in muscle foods. Effects enzyme dose, pH, and calcium ion on the ability to inhibit trout hemoglobin-mediated were investigated washed cod (WCM). Results indicated that required both hydrol...

Hemoglobin-oxygen association curves of human erythrocytes were measured in metabolically stable cells under the standardized conditions of extracellular pH 7.400, carbon dioxide tension 38 mmHg (approximately 5 kPa) and temperature 37 degrees C. A model of the oxygen association curve of normal erythrocytes was subsequently developed, based on assumed equilibrium reactions between hemoglobins ...

Toxoplasmosis is one of the most common zoonoses worldwide. The seroprevalence for T. gondii in human population from Brazil might range from 40 to 80%. The aim of this paper was to study the seroprevalence of T. gondii infection in children from age one to 15 living in a low socioeconomic community, named community of Jardim São Remo in the year of 2002. The community is located in the West ar...

background & aim: marshmallow (althaea officinalis) is one of the most popular medicinal plants used in traditional medicine with antibacterial and antioxidant properties. this study was conducted to evaluate the effects of marshmallow extract (althaea officinalis l.) administration on blood cells and biochemical parameters of carp liver. experimental: 150 carp (weighing 37.65 ± 4.40 g) wer...

introduction hemoglobin (hb) levels in fetus increase with progression of pregnancy, reaching highest levels in life. hb serves as iron reserve in fetus and is needed for the infant to adapt with anemia. many factors can decrease hb levels at birth and lead to accelerated physiological anemia. hence, the infant would require earlier administration of iron drops. identification of these factors ...

Background: Iron deficiency anemia is a major public health problem in the developing countries. Anemia decreases physical capacity and adversely affects performance in women. The aim of this study was to evaluate the prevalence of anemia based on some hematological parameters among women of reproductive age in Kermanshah, Western Iran. Methods: We conducted a cross-sectional study in Kermansha...

Leishmania internalize hemoglobin (Hb) via a specific receptor (HbR) for their survival. To identify the Hb-binding domain of HbR, we cloned and expressed several truncated proteins HbR determined ability to bind Hb. Our findings reveal that 90% activity is retained in HbR41–80 comparison with HbR1–471. We synthesized 40 amino acid peptide (SSEKMKQLTMYMIHEMVEGLEGRPSTVRMLPSFVYTSDPA) correspondin...

It is hypothesized that oxidative reactions of hemoglobin driven by reactive oxygen species in the vasculature lead to endothelial cell injury or death. Bovine aortic endothelial cells were incubated with diaspirin cross-linked hemoglobin (DBBF-Hb), developed as a hemoglobin-based oxygen carrier, and hydrogen peroxide (H(2)O(2)), generated by the glucose oxidase system. The low steady flux of H...

CONTEXT AND OBJECTIVE Hemoglobinopathies are among the commonest and most widespread genetic disorders worldwide. Their prevalence varies according to ethnic composition and/or geographical region. The aim of this study was to investigate the presence of hemoglobinopathies and their association with ethnicity among 1,004 newborns, to confirm the guideline of the Brazilian National Neonatal Scre...

SEVERAL HEMOGLOBINOPATHIES of man are known to produce striking morphologic changes in erythrocytes. In vivo sickling, occurring under low oxygen tension, is well documented in hemoglobin 5 (1-lb S) disease. Osmotic dehydration produced by incubation in hypertonic salt solutions fosters sickling in these cells.’ This phenomenon is explained on the basis of a single amino acid substitution, vali...