نتایج جستجو برای: bahram behin

تعداد نتایج: 131  

2004
Vikas Gupta

m One of th'e most challenging concerns of Urosurgeons is to be able to diagnose a prostate cancer non-i;nvasivel~@xisting techniques for diagnosis of prostate cancer are a invakive in nature and lack concern for patient safety and comfort. These concerns have been the compelling force for urosurgeons to investigate new non-invasive techniques for the detection of prostate cancer in men: Urodyn...

ژورنال: زبان پژوهی 2016
افشین رحیمی بهرام وزیرنژاد محرم اسلامی,

توزیع رسایی در خوشة دوهمخوانیمرز هجا در زبان فارسی   افشین رحیمی[1] محرم اسلامی[2] بهرام وزیرنژاد[3] دریافت: 11/7/91 تصویب: 26/8/92   چکیده در این مقاله، توزیع رسایی درخوشه‌های دوهمخوانی مرز دو هجای CVC-CVC در واژه‌های زبان فارسی مورد بررسی قرار گرفته است. محدودیت رسایی در مرز هجا بیانگر  تمایل جهانی در جهت تغییر افتان رسایی همخوان‌ها در مرز هجا است. در این بررسی، تعداد 4202 واژه از وا...

The Effect of Socio-Economic Situation on Smoking in Urban Households of Iran Mohsen Hasani 1, Bahram Sahabi 1, *, Sajjad Faraji Dizaji 1, Gharaman Abdoli2 1Faculty of Management and Economics, Tarbiat Modares University, Tehran, Iran 2Faculty of Economics, Tehran University, Tehran, Iran Abstract Background: To adopt the best strategies to reduce smoking, identifying the factors that affect ...

2003
Mohammad Jalal Abbasi-Shavazi

In 1996, four provinces of Iran experienced below replacement level fertility. Since the early 1980s, these provinces have recorded lower fertility than the national level. How and under what condition has fertility declined to such a low level in these provinces? It may be of considerable interest to examine whether these provinces can be regarded as the leaders of the fertility transition in ...

2008
Lisa Berglund

The human genome is predicted to contain ~20,500 protein-coding genes. The encoded proteins are the key players in the body, but the functions and localizations of most proteins are still unknown. Antibody-based proteomics has great potential for exploration of the protein complement of the human genome, but there are antibodies only to a very limited set of proteins. The Human Proteome Resourc...

ژورنال: :زبان پژوهی 0
افشین رحیمی دانشگاه ملبورن محرم اسلامی دانشگاه زنجان بهرام وزیرنژاد دانشگاه صنعتی شریف

توزیع رسایی در خوشه دوهمخوانیمرز هجا در زبان فارسی   افشین رحیمی[1] محرم اسلامی[2] بهرام وزیرنژاد[3] دریافت: 11/7/91 تصویب: 26/8/92   چکیده در این مقاله، توزیع رسایی درخوشه های دوهمخوانی مرز دو هجای cvc-cvc در واژه های زبان فارسی مورد بررسی قرار گرفته است. محدودیت رسایی در مرز هجا بیانگر  تمایل جهانی در جهت تغییر افتان رسایی همخوان ها در مرز هجا است. در این بررسی، تعداد 4202 واژه از واژه های زا...

2006
Bertfried Fauser

We will give an introduction to Rota-Baxter algebras which started with a probability study of Spitzer in 1950s and found interesting applications in the work of Connes and Kreimer on renormalization of QFT. We will discuss their basic properties, the constructions of the free objects and applications to multiple zeta values by renormalization method. Some other applications will be given in Ku...

1998
S. Partula A. de Guerra J. S. Fellah J. Charlemagne D. L. DiGiusto P. Borgulya H. Kishi Y. Uematsu H. von Boehmer H. Suzuki J. A. Punt L. G. Granger W. Swat L. Ignatowicz P. Kisielow B. A. Osborne Y. Takahama S. O. Sharrow A. Singer D. M. Page L. P. Kane J. P. Allison S. M. Hedrick J. Alberola-Ila K. A. Hogquist K. A. Swan M. J. Bevan R. M. Perlmutter C. C. O’Shea T. Crompton I. R. Rosewell A. C. Hayday M. J. Owen

Immunol. 157, 207 (1996). 10. D. L. DiGiusto and E. Palmer, Mol. Immunol. 31, 693 (1994). 11. The a wild-type, b wild-type, aIII, and bIII constructs have been previously described (8). The a wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS (30), with the a-CPM indicated in bold. The b wild-type amino acid sequence fro...

Journal: :هنرهای تجسمی 0
سیدهاشم حسینی استادیار باستان شناسی و هنر دوران اسلامی، دانشکده علوم انسانی، دانشگاه محقق اردبیلی، اردبیل، ایرا

abstract the subject matter of this paper is study of the simurgh pattern's reflection in islamic potteries and tiles of iran. author intends relying on some historic and literary principles as well as identification of drawing characteristics and symbolic concepts of simurgh, detect the cause of difference between islamic simurgh and sassanid simurgh. in addition, he aimed at tracing of p...

Journal: :هنرهای تجسمی 0
یعقوب آژند دانشگاه تهران، دکترا

the iranian world has a well-established tradition of images that goes back to anitiquity. the structure relation between text and image become increasingly intricate in illustrated manuscripts, at least from the middle of forteenth century onwards. these links can be observed through the composition and layout of the paintings. these relations seem to be expressed in some persian poetical text...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید