نتایج جستجو برای: dopaminergic neurotransmission

تعداد نتایج: 27281  

1998
S. Partula A. de Guerra J. S. Fellah J. Charlemagne D. L. DiGiusto P. Borgulya H. Kishi Y. Uematsu H. von Boehmer H. Suzuki J. A. Punt L. G. Granger W. Swat L. Ignatowicz P. Kisielow B. A. Osborne Y. Takahama S. O. Sharrow A. Singer D. M. Page L. P. Kane J. P. Allison S. M. Hedrick J. Alberola-Ila K. A. Hogquist K. A. Swan M. J. Bevan R. M. Perlmutter C. C. O’Shea T. Crompton I. R. Rosewell A. C. Hayday M. J. Owen

Immunol. 157, 207 (1996). 10. D. L. DiGiusto and E. Palmer, Mol. Immunol. 31, 693 (1994). 11. The a wild-type, b wild-type, aIII, and bIII constructs have been previously described (8). The a wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS (30), with the a-CPM indicated in bold. The b wild-type amino acid sequence fro...

2011
Wouter Goutier John P. Lowry

s and Posters J.A. Brennan, R.L. Navarra, S.M. Grauer, A.C. McCreary, J.H. Reinders, W. Goutier, P. vander Feer, K. Marquis, M.A.W. vander Neut, D. Rotella, R. Feenstra and M.H. Pausch. Antipsychotic-Like Profile of WS-50030, A Combined Partial D2 Receptor Agonist and Selective Serotonin Reuptake Inhibitor”. Society for Neuroscience, Washington, DC, USA, 2008 Goutier W., Spaans P.A., van der Ne...

2016
Valtteri Kaasinen

OBJECTIVE The nigral lesion and the resulting contralateral motor signs of Parkinson's disease (PD) are remarkably asymmetric. This study investigated the prevalence of patients with "wrong-sided" lesions, that is, patients with symptoms on the side ipsilateral to the predominant dopaminergic nigrostriatal deficit. METHODS The analyzed sample included 434 early unmedicated PD patients from th...

Journal: :Trends in neurosciences 2009
Emrah Düzel Nico Bunzeck Marc Guitart-Masip Bianca Wittmann Bjoern H Schott Philippe N Tobler

Invasive recording of dopamine neurons in the substantia nigra and ventral tegmental area (SN/VTA) of behaving animals suggests a role for these neurons in reward learning and novelty processing. In humans, functional magnetic resonance imaging (fMRI) is currently the only non-invasive event-related method to measure SN/VTA activity, but it is debated to what extent fMRI enables inference about...

Journal: :Molecular pharmacology 2005
C L Parish J Nunan D I Finkelstein F N McNamara J Y Wong J L Waddington R M Brown A J Lawrence M K Horne J Drago

Neuronal nicotinic acetylcholine receptors (nAChRs) at presynaptic sites can modulate dopaminergic synaptic transmission by regulating dopamine (DA) release and uptake. Dopaminergic transmission in nigrostriatal and mesolimbic pathways is vital for the coordination of movement and is associated with learning and behavioral reinforcement. We reported recently that the D2 DA receptor plays a cent...

Journal: :Proceedings of the National Academy of Sciences of the United States of America 2009
Youren Tong Antonio Pisani Giuseppina Martella Maha Karouani Hiroo Yamaguchi Emmanuel N Pothos Jie Shen

Dominantly inherited mutations in leucine-rich repeat kinase 2 (LRRK2) are a common genetic cause of Parkinson's disease (PD). The importance of the R1441 residue in the pathogenesis is highlighted by the identification of three distinct missense mutations. To investigate the pathogenic mechanism underlying LRRK2 dysfunction, we generated a knockin (KI) mouse in which the R1441C mutation is exp...

2017
Zhimin Xu Xingkun Chu Houbo Jiang Haley Schilling Shengdi Chen Jian Feng

Motor symptoms that define Parkinson's disease (PD) are caused by the selective loss of nigral dopaminergic (DA) neurons. Cell replacement therapy for PD has been focused on midbrain DA neurons derived from human fetal mesencephalic tissue, human embryonic stem cells (hESC) or human induced pluripotent stem cells (iPSC). Recent development in the direct conversion of human fibroblasts to induce...

Journal: :Clinical pharmacology and therapeutics 2009
S Bodenmann S Xu U F O Luhmann M Arand W Berger H H Jung H P Landolt

Sleep loss impairs waking functions and is homeostatically compensated in recovery sleep. The mechanisms underlying the consequences of prolonged wakefulness are unknown. The stimulant modafinil may promote primarily dopaminergic neurotransmission. Catechol-O-methyltransferase (COMT) catalyzes the breakdown of cerebral dopamine. A functional Val158Met polymorphism reduces COMT activity, and Val...

Journal: :Journal of neuropathology and experimental neurology 2010
Ali Jahanshahi Rinske Vlamings Ahmet Hilmi Kaya Lee Wei Lim Marcus L F Janssen Sonny Tan Veerle Visser-Vandewalle Harry W M Steinbusch Yasin Temel

Huntington disease has been linked to increased dopaminergic neurotransmission in the striatum, and clinical studies have demonstrated that the associated chorea can be treated with dopamine antagonist or dopamine-depleting drugs. The origin of this hyperdopaminergic status is unknown. Because substantia nigra pars compacta and the ventral tegmental area are the main sources of striatal dopamin...

نمودار تعداد نتایج جستجو در هر سال

با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید