نتایج جستجو برای: dopaminergic neurotransmission
تعداد نتایج: 27281 فیلتر نتایج به سال:
Immunol. 157, 207 (1996). 10. D. L. DiGiusto and E. Palmer, Mol. Immunol. 31, 693 (1994). 11. The a wild-type, b wild-type, aIII, and bIII constructs have been previously described (8). The a wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS (30), with the a-CPM indicated in bold. The b wild-type amino acid sequence fro...
s and Posters J.A. Brennan, R.L. Navarra, S.M. Grauer, A.C. McCreary, J.H. Reinders, W. Goutier, P. vander Feer, K. Marquis, M.A.W. vander Neut, D. Rotella, R. Feenstra and M.H. Pausch. Antipsychotic-Like Profile of WS-50030, A Combined Partial D2 Receptor Agonist and Selective Serotonin Reuptake Inhibitor”. Society for Neuroscience, Washington, DC, USA, 2008 Goutier W., Spaans P.A., van der Ne...
OBJECTIVE The nigral lesion and the resulting contralateral motor signs of Parkinson's disease (PD) are remarkably asymmetric. This study investigated the prevalence of patients with "wrong-sided" lesions, that is, patients with symptoms on the side ipsilateral to the predominant dopaminergic nigrostriatal deficit. METHODS The analyzed sample included 434 early unmedicated PD patients from th...
Invasive recording of dopamine neurons in the substantia nigra and ventral tegmental area (SN/VTA) of behaving animals suggests a role for these neurons in reward learning and novelty processing. In humans, functional magnetic resonance imaging (fMRI) is currently the only non-invasive event-related method to measure SN/VTA activity, but it is debated to what extent fMRI enables inference about...
Neuronal nicotinic acetylcholine receptors (nAChRs) at presynaptic sites can modulate dopaminergic synaptic transmission by regulating dopamine (DA) release and uptake. Dopaminergic transmission in nigrostriatal and mesolimbic pathways is vital for the coordination of movement and is associated with learning and behavioral reinforcement. We reported recently that the D2 DA receptor plays a cent...
Dominantly inherited mutations in leucine-rich repeat kinase 2 (LRRK2) are a common genetic cause of Parkinson's disease (PD). The importance of the R1441 residue in the pathogenesis is highlighted by the identification of three distinct missense mutations. To investigate the pathogenic mechanism underlying LRRK2 dysfunction, we generated a knockin (KI) mouse in which the R1441C mutation is exp...
Motor symptoms that define Parkinson's disease (PD) are caused by the selective loss of nigral dopaminergic (DA) neurons. Cell replacement therapy for PD has been focused on midbrain DA neurons derived from human fetal mesencephalic tissue, human embryonic stem cells (hESC) or human induced pluripotent stem cells (iPSC). Recent development in the direct conversion of human fibroblasts to induce...
Sleep loss impairs waking functions and is homeostatically compensated in recovery sleep. The mechanisms underlying the consequences of prolonged wakefulness are unknown. The stimulant modafinil may promote primarily dopaminergic neurotransmission. Catechol-O-methyltransferase (COMT) catalyzes the breakdown of cerebral dopamine. A functional Val158Met polymorphism reduces COMT activity, and Val...
Huntington disease has been linked to increased dopaminergic neurotransmission in the striatum, and clinical studies have demonstrated that the associated chorea can be treated with dopamine antagonist or dopamine-depleting drugs. The origin of this hyperdopaminergic status is unknown. Because substantia nigra pars compacta and the ventral tegmental area are the main sources of striatal dopamin...
نمودار تعداد نتایج جستجو در هر سال
با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید