نتایج جستجو برای: bahram
تعداد نتایج: 112 فیلتر نتایج به سال:
Immunol. 157, 207 (1996). 10. D. L. DiGiusto and E. Palmer, Mol. Immunol. 31, 693 (1994). 11. The a wild-type, b wild-type, aIII, and bIII constructs have been previously described (8). The a wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS (30), with the a-CPM indicated in bold. The b wild-type amino acid sequence fro...
abstract the subject matter of this paper is study of the simurgh pattern's reflection in islamic potteries and tiles of iran. author intends relying on some historic and literary principles as well as identification of drawing characteristics and symbolic concepts of simurgh, detect the cause of difference between islamic simurgh and sassanid simurgh. in addition, he aimed at tracing of p...
the iranian world has a well-established tradition of images that goes back to anitiquity. the structure relation between text and image become increasingly intricate in illustrated manuscripts, at least from the middle of forteenth century onwards. these links can be observed through the composition and layout of the paintings. these relations seem to be expressed in some persian poetical text...
SNP-level analysis of 5,000+ metagenomic samples enabled Hildebrand et al., 2021Hildebrand F. Gossmann T.I. Frioux C. Özkurt E. Myers P.N. Ferretti P. Kuhn M. Bahram Nielsen H.B. Bork Dispersal strategies shape persistence and evolution human gut bacteria.Cell Host Microbe. 2021; 29 (S1931-3128(21)00236-5)https://doi.org/10.1016/j.chom.2021.05.008Abstract Full Text PDF Scopus (14) Google Schola...
introduction: recently, consumers have directed their interest towards low fat products as they associated them with a reduced risk of well-known health problems such as obesity and coronary heart diseases. fat is a multifunctional ingredient in ice cream system. thus, in attempts to provide desirable flavor and physical characteristics of full fat ice cream, manufactures looking for fat replac...
In this issue of Structure, Juaire et al. use X-ray crystallography, biophysical tools, and cell-based assays to investigate disease-associated variants the SRP54 GTPase demonstrate that defects in SRP-mediated protein secretion can explain phenotypes severe neutropenia with Shwachman-Diamond-syndrome-like symptoms. The advent modern DNA sequencing technology has revolutionized biology medicine...
abstract bazel mashadi′s heydary attack is one of the earliest and most famous attack epics written in the twelfth century. bazel exploits the style and format of shahname in his masnavi, composed in twenty to thirty thousand verses. the poet, after chanting the praise of god, prophet and his successor (vali), verses the history of islam beginning from the prophet’s mission (be’sat) to the orde...
Arg-e Bam complex is considered as one of the most important ancient Iranian-Islamic cities. This complex is the historical axis of Bam city and is located in the east of Kerman province. Abundant research has been carried out on the urban structure of the Bam so far, and each of these studies has achieved significant results, but some parts of it have been rarely considered by researchers. One...
Ephrin-B1 is one of the critical components slit diaphragm kidney glomerular podocyte. However, precise function ephrin-B1 unclear. To clarify ephrin-B1, ephrin-B1–associated molecules were studied. RNA-sequencing analysis suggested that Na+/H+ exchanger regulatory factor 2 (NHERF2), a scaffolding protein, associated with ephrin-B1. NHERF2 was expressed at apical area and diaphragm, interacted ...
extended abstract 1. introduction the translation of literary works in iran has always been subject to social and political conditions, intellectual tendencies, and dominant ideologies of the related historical period. hence, in each period the translators were inclined to translate specific literary works according to the beliefs and viewpoint of a distinguished political and social group. thu...
نمودار تعداد نتایج جستجو در هر سال
با کلیک روی نمودار نتایج را به سال انتشار فیلتر کنید